PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.001G204600.1
Common NamePHAVU_001G204600g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family HB-other
Protein Properties Length: 1027aa    MW: 114152 Da    PI: 9.58
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.001G204600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox17.38.4e-0669125157
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                         +r+R  ++++ ++ +++ F  +  +s++e +e+++  g+t +qV+ +F  +R + ++
  Phvul.001G204600.1  69 KRPRDLLNPKAVNYMQSIFSIKDSISKKELREISALFGVTATQVRDFFTGQRSRVRR 125
                         799**************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.8E-565120IPR009057Homeodomain-like
PROSITE profilePS500719.76666126IPR001356Homeobox domain
SMARTSM003894.6E-468130IPR001356Homeobox domain
CDDcd000861.71E-469125No hitNo description
SuperFamilySSF466892.95E-669131IPR009057Homeodomain-like
Gene3DG3DSA:1.20.930.107.5E-5224310IPR017923Transcription factor IIS, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006351Biological Processtranscription, DNA-templated
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1027 aa     Download sequence    Send to blast
MDAWNEDFVE QEIGSSAESF QKFLLSQRDL FHSQIDQFQE IVVTQCKLTG VNPLSQEMAA  60
GALSIKIGKR PRDLLNPKAV NYMQSIFSIK DSISKKELRE ISALFGVTAT QVRDFFTGQR  120
SRVRRLVQFS KERALGSTSC GDPHDDKIIS DPVRLINPAS LNSTVPSSAE EASCSTQDAA  180
LSDLDDSDKH FVDNIFSLMQ KEETFSGQEK LMEWILTIQN SSVLLWFLNR EGGITLATWL  240
NKATVEEQTS VLLLILKVLC HLPLHKAIPM HISAILQSVN KLRFYRASDI SNRARILLSK  300
WSKLLARNQV IKKPNGVRPS SDGHKELISQ SIGQFVGSES WHSNIDVPED FFSLSSECLD  360
NFRKVGSSQA AKLLTPSLDD SSKKSTLGVL SSQSRERRKI QLVEQPGQKS VSRNSQVTRA  420
GPVSQGRPMS ADDIQKAKMR ALFMQSKYGK SGSKESKETK IDSLNKQPQT IPASIAACSS  480
KAPTPYKIDE NKKPLLLASK TSNRLEAYSK PKMDVKEPLW EKCMRVQIPW KRPAEVELKD  540
TWRVGSGENS KEVDAQRNRD RREKETIYKT IQEIPPNPKE PWDLEMDYDD TLTLEIPIEQ  600
LPDGDGADIT VSPNQVAAHT VQGVASTSST SMAPAEPDLE LLAVLLKNPE LVFALTSGQA  660
GSIPSEEIVK LLDMIKRGGA NLGLSENTNG SYGTSVKAPE KVEVSLPSPT PLSDPRTNGW  720
SSEASKNPFS RRSVASDRII QNHAAVATPN LLTQIPVTST TTVRQQPTVV VSSSRHLTST  780
AVSPYSLHQA TNVNPEKQQP VGHVQIPPSN VGLTMKKNLI TTNASSVNFS GTHTTLSMRS  840
NGTNYGNDTN YVKPVHNLSV QHEGLSNSFP QSSFKLPSPT PSNSASHQHV VQEAHYTEPP  900
YRNPSRSYPP QTEKSDHGSE SMWRVRQDVS PSYHSQRNHN NYNAMAGGSR QSGVWDRNNH  960
GREGFESWSP ENSPTRNPRH IPGRNYPESR VNHGRNHRPE WSRERGSSGH WDPGRQVNRK  1020
WHDQRR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ8407700.0HQ840770.1 Phaseolus vulgaris clone BAC B1-157 genotype G19833, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007163082.10.0hypothetical protein PHAVU_001G204600g
SwissprotQ387961e-160LUMI_ARATH; Homeobox protein LUMINIDEPENDENS
TrEMBLV7D1K20.0V7D1K2_PHAVU; Uncharacterized protein
STRINGGLYMA03G36970.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF98092934
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.21e-133HB-other family protein